superscript iv vilo reverse transcriptase kit  (Thermo Fisher)

Article Title: Barcoded Rabies In Situ Connectomics for high-throughput reconstruction of neural circuits
Article Snippet: .. The mix contained pooled gene-specific reverse transcription primers (60 nM per primer), 1 μM rabies barcode reverse transcription primer (RTAB0067, Supplementary Table 3), 1 U/μl RiboLock RNase Inhibitor (Thermo Fisher Scientific, EO0381), 0.2 μg/μl non-acetylated BSA (Thermo Fisher Scientific, AM2616), 0.5 mM dNTP (Thermo Fisher Scientific, R0192), 20 U/μl SuperScript IV reverse transcriptase (Thermo Fisher Scientific, 18090200), 5 mM DTT (Thermo Scientific, 707265) in 1X SuperScript IV buffer. ..

Article Title: MYC modulates TOP2A diffusion to promote substrate detection and activity
Article Snippet: .. 4 ul RT buffer, 0.3 ul SuperScript IV Reverse Transcriptase (both Thermo, 18090200), 1 ul 0.1 M DTT (Sigma, 43815) and 0.2 ul of RNAsin Ribonuclease inhibitor (Promega, N2515) were added. ..

Article Title: Acidic environments trigger intracellular H-sensing FAK proteins to re-balance sarcolemmal acid-base transporters and auto-regulate cardiomyocyte pH
Article Snippet: Total RNA was extracted from NRVMs using TRIzol (Invitrogen), and extracted from heart tissue using RNeasy Fibrous Tissue Mini Kit (Qiagen). .. RNA samples were reverse transcribed using SuperScript IV Reverse Transcriptase (Thermo Fisher Scientific) according to manufacturer’s instructions. .. Quantitative real-time PCR was performed in duplex reactions with housekeeping genes using TaqMan probes (Applied Biosystems).

Article Title: DLL3 single domain antibodies and therapeutic compositions thereof
Article Snippet: .. Llamas and alpacas were immunized with a recombinant version of the human DLL3 extracellular domain (ECD; amino acids 27-492 of human DLL3, e.g. UniProt No. Q9NYJ7) set forth as follows (SEQ ID NO:475): AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAES PCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFII ETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFS YRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRA GCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCL VPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGP CFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCL DLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCA LGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFP VHPDGASALPAAPPGLRPGDPQRYL Following the development of specific anti-DLL3 antibody titers, llama/alpaca peripheral blood mononuclear cells (PBMCs) were isolated from 500 mL of blood from the immunized animal and total mRNA was isolated using the Qiagen RNeasy Maxi Kit and subsequently converted to first strand cDNA using Thermo Superscript IV Reverse Transcriptase and oligo-dT priming. ..

Article Title: Fatty Acid Synthase binds endogenous dsRNAs and dampens the innate immune response to exogenous dsRNAs by limiting their accumulation
Article Snippet: .. For total RNA analysis, 1μg or 500ng of total RNA were treated with DNase I (Invitrogen, Thermo Fisher Scientific) and then reverse transcribed using oligo(N9) primer with the SuperScript IV reverse transcriptase (Invitrogen, Thermo Fisher Scientific) according to the manufacturer’s instruction. .. Quantitative Real-time (q)PCR analysis was performed and analyzed using CFX96 touch Real-Time PCR machine (Bio-Rad).

Article Title: Barcoded Rabies In Situ Connectomics for high-throughput reconstruction of neural circuits
Article Snippet: For viral libraries, viral genomic RNA was extracted using the Quick DNA/RNA Viral Kit (Zymo Research, D7020) and eluted into 15 μl of RNase-free water. .. Purified viral barcode RNA was then reverse transcribed using Superscript IV reverse transcriptase (Thermo Fisher Scientific, 18090050) at 50 °C for 10 minutes with 1 μl of 2 μM UMI_P5_Truseq primer (Supplementary Table 1), before heat inactivation at 80 °C for 10 minutes. .. RNA was subsequently digested with RNase H (New England Biolabs, M0297S) at 37 °C for 20 minutes.

Article Title: Probiotic secretomes attenuate inflammation and disrupted antioxidant status induced by polychlorinated biphenyls in human intestinal T84 epithelial cells.
Article Snippet: 300 words limits) 31 32 Polychlorinated biphenyls (PCBs) are persistent organic pollutants linked with intestinal 33 inflammation and disrupted antioxidant status.. Humans are exposed to PCBs primarily via PCB34 contaminated foods.. A comprehensive analysis of PCB modulation of intestinal inflammatory 35 networks is lacking.

Article Title: DLL3 single domain antibodies and therapeutic compositions thereof
Article Snippet: .. Llamas and alpacas were immunized with a recombinant version of the human DLL3 extracellular domain (ECD; amino acids 27-492 of human DLL3, e.g. UniProt No. Q9NYJ7) set forth as follows (SEQ ID NO:475): AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAES PCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFII ETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFS YRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRA GCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCL VPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGP CFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCL DLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCA LGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFP VHPDGASALPAAPPGLRPGDPQRYL Following the development of specific anti-DLL3 antibody titers, llama/alpaca peripheral blood mononuclear cells (PBMCs) were isolated from 500 mL of blood from the immunized animal and total mRNA was isolated using the Qiagen RNeasy Maxi Kit and subsequently converted to first strand cDNA using Thermo Superscript IV Reverse Transcriptase and oligo-dT priming. ..

Article Title: DLL3 single domain antibodies and therapeutic compositions thereof
Article Snippet: .. Llamas and alpacas were immunized with a recombinant version of the human DLL3 extracellular domain (ECD; amino acids 27-492 of human DLL3, e.g. UniProt No. Q9NYJ7) set forth as follows (SEQ ID NO:475): AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAES PCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFII ETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFS YRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRA GCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCL VPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGP CFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCL DLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCA LGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFP VHPDGASALPAAPPGLRPGDPQRYL Following the development of specific anti-DLL3 antibody titers, llama/alpaca peripheral blood mononuclear cells (PBMCs) were isolated from 500 mL of blood from the immunized animal and total mRNA was isolated using the Qiagen RNeasy Maxi Kit and subsequently converted to first strand cDNA using Thermo Superscript IV Reverse Transcriptase and oligo-dT priming. ..

Article Title: Fatty Acid Synthase binds endogenous dsRNAs and dampens the innate immune response to exogenous dsRNAs by limiting their accumulation
Article Snippet: .. For total RNA analysis, 1μg or 500ng of total RNA were treated with DNase I (Invitrogen, Thermo Fisher Scientific) and then reverse transcribed using oligo(N9) primer with the SuperScript IV reverse transcriptase (Invitrogen, Thermo Fisher Scientific) according to the manufacturer’s instruction. .. Quantitative Real-time (q)PCR analysis was performed and analyzed using CFX96 touch Real-Time PCR machine (Bio-Rad).

Article Title: TRESK background potassium channel regulates MrgprA3 + pruriceptor excitability, acute and chronic itch.
Article Snippet: A subset of peripheral sensory neurons expressing specific Mas-related G-protein–coupled receptors and transient receptor potential channels mediate pruritogen-induced chemical itch.. However, the molecular mechanisms that regulate the excitability of these cells, and consequently itch sensation, are poorly understood.. TWIK-related spinal cord K channel (TRESK) is a background K channel that modulates the restingmembrane potential, action potential firing, and neuronal excitability, and it has been involved in somatosensation and pain transduction.

Article Title: Barcoded Rabies In Situ Connectomics for high-throughput reconstruction of neural circuits
Article Snippet: For viral libraries, viral genomic RNA was extracted using the Quick DNA/RNA Viral Kit (Zymo Research, D7020) and eluted into 15 μl of RNase-free water. .. Purified viral barcode RNA was then reverse transcribed using Superscript IV reverse transcriptase (Thermo Fisher Scientific, 18090050) at 50 °C for 10 minutes with 1 μl of 2 μM UMI_P5_Truseq primer (Supplementary Table 1), before heat inactivation at 80 °C for 10 minutes. .. RNA was subsequently digested with RNase H (New England Biolabs, M0297S) at 37 °C for 20 minutes.